PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400014219
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GATA
Protein Properties Length: 187aa    MW: 20836.2 Da    PI: 10.3914
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400014219genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA62.35.6e-2071104134
                  GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                           C++C +tkTp+WR+gp g+ktLCnaCG++yr+ +
  PGSC0003DMP400014219  71 CTHCEVTKTPQWREGPLGPKTLCNACGVRYRSGR 104
                           *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004016.6E-1565115IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.35869101IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.6E-1470102IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577164.32E-1570128No hitNo description
CDDcd002021.83E-1670127No hitNo description
PROSITE patternPS0034407196IPR000679Zinc finger, GATA-type
PfamPF003208.5E-1871105IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MAPISSTRVA SKKISDARKT KEKRRRLSLL SGAKEPMKNY VQQINDAALP LSDVYKKKIT  60
STQQSSFFKK CTHCEVTKTP QWREGPLGPK TLCNACGVRY RSGRLFPEYR PAASPTFVPS  120
VHSNSHRKVV EMRKKTLYGT GEVEEPPKVI MGRKSEALPE PTIVADPAMS PAPEFVPMSS  180
YLFDVY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12226KRRRL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00130DAPTransfer from AT1G08010Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754500.0HG975450.1 Solanum pennellii chromosome ch11, complete genome.
GenBankHG9755230.0HG975523.1 Solanum lycopersicum chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006340186.11e-134PREDICTED: GATA transcription factor 11-like
TrEMBLM1AE851e-136M1AE85_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000208761e-133(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.23e-41GATA transcription factor 11
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]